SARS-CoV-2 Spike RBD #VPS1

SARS-CoV-2 Spike RBD #VPS1

$199.00Price

Recombinant Protein

Size
  • Product Details

    Aliases: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike protein (S) receptor binding domain (RBD); 2019 novel coronavirus spike glycoprotein RBD, SARS-CoV-2 S1, SARS-CoV-2 S protein RBD; S glycoprotein RBD; S-RBD

    UniProt Accession No.: P59594

    NCBI Reference Sequence: YP_009724390.1

    Host Species: SARS-CoV-2 spike glycoprotein (S) protein RBD is a recombinant protein produced in HEK293 cell line.

    Amino Acid Sequence:

    RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFHHHHHH

    Purity: > 95% as established by reducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis

    Tag: Six histidine (His) residues at the C-terminus of the protein

    Molecular Weight: 27 kDa

    Validated Applications: ELISA

    Storage Buffer: 0.02 M Tris buffer, pH 8.0

    Storage Condition: < -20°C, stable for 1 year after receipt. Avoid repeated freeze-thaw cycles.

  • Background

    The single-stranded, plus-sense severe acute respiratory syndrome coronavirus 2 (SARS–CoV-2) genome encodes nonstructural replicase polyproteins as well as structural proteins such as spike (S), nucleocapsid (N), membrane (M), and envelop (E) proteins (Zhou et al., 2020). S protein is a transmembrane homotrimeric class I fusion glycoprotein; the S1 subunit binds to angiotensin-converting enzyme II (ACE2) and S2 subunit is involved in the fusion of viral and host cell membranes (Sternberg and Naujokat, 2020). The distal subunit S1 contains a receptor binding domain (RBD, residues Arg319-Phe541, GenBank accession: YP_009724390.1), whose hinge-like conformational movement is required for ACE2 receptor binding and refolding of S2 for membrane fusion (Walls et al., 2020; Wrapp et al., 2020). Accumulating evidence from convalescent COVID-19 individuals supports that RBD is a highly immunogenic epitope targeted by neutralizing monoclonal antibodies through adaptive immune responses mediated by CD4+ T cells (Cao et al., 2020; Grifoni et al., 2020). As such, S and its RBD have been targets for vaccine design and development to prevent SARS-CoV-2 infection and rechallenge (Sternberg and Naujokat, 2020).

     

    Cao, Y., Su, B., Guo, X., Sun, W., Deng, Y., Bao, L., Zhu, Q., Zhang, X., Zheng, Y., Geng, C., et al. (2020). Potent Neutralizing Antibodies against SARS-CoV-2 Identified by High-Throughput Single-Cell Sequencing of Convalescent Patients' B Cells. Cell 182, 73-84 e16.

    Grifoni, A., Weiskopf, D., Ramirez, S.I., Mateus, J., Dan, J.M., Moderbacher, C.R., Rawlings, S.A., Sutherland, A., Premkumar, L., Jadi, R.S., et al. (2020). Targets of T Cell Responses to SARS-CoV-2 Coronavirus in Humans with COVID-19 Disease and Unexposed Individuals. Cell 181, 1489-1501 e1415.

    Sternberg, A., and Naujokat, C. (2020). Structural features of coronavirus SARS-CoV-2 spike protein: Targets for vaccination. Life Sci 257, 118056.

    Walls, A.C., Park, Y.J., Tortorici, M.A., Wall, A., McGuire, A.T., and Veesler, D. (2020). Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein. Cell 181, 281-292 e286.

    Wrapp, D., Wang, N., Corbett, K.S., Goldsmith, J.A., Hsieh, C.L., Abiona, O., Graham, B.S., and McLellan, J.S. (2020). Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation. Science 367, 1260-1263.

    Zhou, P., Yang, X.L., Wang, X.G., Hu, B., Zhang, L., Zhang, W., Si, H.R., Zhu, Y., Li, B., Huang, C.L., et al. (2020). A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature 579, 270-273.

  • Product Features

    • Recombinant protein in human cell line HEK293
    • Verified with rabbit monoclonal antibodies using contrived human nasopharyngeal swab specimens
    • Can be used as an antigen to detect neutralizing antibodies in convalescent COVID-19 patient sera

Support

Orders

sales@genuinbiotech.com

Technical

info@genuinbiotech.com

_edited.png

®

Technical Support: info@genuinbiotech.com

Sales & Quotation: sales@genuinbiotech.com 

Office Hours: 8:30AM - 5:30PM EST Mon-Fri

Tel: 540.605.9777; Fax: 540.605.9771

2270 Kraft Drive, Suite 1311, Blacksburg, VA, 24060

Phone: 540.605.9777; Fax: 540.605.9771

©2018 by GenuIN Biotech